Products Categories
    Product Certification&
    Enterprise Certification

  • Ms.May
    Tel: 18040586360

  • Mobile:8618040586360
  • Tel:18040586360
  • Fax:
  • Province/state:Hubei
  • City:武汉市
  • Street:塔子湖东路18号越秀星汇君泊S
  • MaxCard:
Home > Products >  Calcitonin Salmon / Salmon Calcitonin Acetate Medicine Grade Salmon Calcitonin CAS 47931-85-1

Calcitonin Salmon / Salmon Calcitonin Acetate Medicine Grade Salmon Calcitonin CAS 47931-85-1 CAS NO.47931-85-1

  • FOB Price: USD: 0.02-0.03 /Gram Get Latest Price
  • Min.Order: 1 Gram
  • Payment Terms: L/C,D/A,D/P,T/T,Other
  • Available Specifications:

    Top(1-1000)GramTop(1000-2000)Gram

  • Product Details

Keywords

  • Calcitonin salmon supplier in China
  • Calcitonin salmon Competitive price
  • Calcitonin salmon exporter in China

Quick Details

  • ProName: Calcitonin Salmon / Salmon Calcitonin ...
  • CasNo: 47931-85-1
  • Molecular Formula: C145H240N44O48S2
  • Appearance: White powder
  • Application: Calcitonin is produced by the parafoll...
  • DeliveryTime: 3-7days
  • PackAge: bag or barrel or drum
  • Port: Shanghai or Shenzhen or Qingdao
  • ProductionCapacity: 6000 Metric Ton/Day
  • Purity: 99%+
  • Storage: Store at room temperature
  • Transportation: by express or air or sea
  • LimitNum: 1 Gram
  • Moisture Content: <0.001%
  • Impurity: <0.001%
  • Assay: 99%+
  • Shelf Life: 2 years
  • Appearance: White Powder

Superiority

Description:

Name:Calcitonin Acetate(Salmon)

Cas No: 47931-85-1(net)

Formula: C145H240N44O48S2

Molecular: 3431.85

Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP

Purity:98%

Appearance: white powder

Source: synthetic

Also known as: Calcihexal  Calcimar  Cibacalcin  Fortical  Miacalcin  Salcatonin

English name: Calcitonin salmon

CAS number: 47931-85-1

Molecular formula: C145H240N44O48S2

Molecular weight: 3431.85

EINECS Number: 256-342-8

Melting point:>222oC(dec.)

Density: 1.54±0.1g/cm3(Predicted)

Storage conditions: −20°C

Solubility: 0.05 M acetic acid: 1mg/mL, clear, colorless

Salmon calcitonin, also known as salmon calcitonin, is a synthetic polypeptide preparation derived from salmon. Salmon calcitonin significantly reduces bone calcium loss in high turnover bone diseases such as osteoporosis, deformed bone disease (Paget's disease), painful neurodystrophy (Sudeck's disease) and malignant osteolysis , the effect on the trunk bone of postmenopausal osteoporosis is more significant than that of the limb bone, and it is more significant on the high turnover bone disease than the low turnover bone disease. Salmon calcitonin can inhibit osteoclast activity and stimulate osteoblast formation and its activity. Calcitonin can also increase urinary calcium, phosphorus and sodium excretion by inhibiting osteolysis and reducing renal tubular resorption. Calcium does not drop below the normal range. The drug also inhibits the secretory activity of the stomach and pancreas, but does not affect gastrointestinal motility. It has been proved that salmon calcitonin has analgesic effect on some patients with painful bone disease. All calcitonins are structurally similar, with a single chain of 32 amino acids in different arrangements. The amino acid order depends on the species, and their functions are basically the same. Among the 32 amino acids of salmon calcitonin and human calcitonin, 16 are different, but the effect and application of the two on Paget's disease of bone are the same. The drug has a high affinity for its receptor binding sites present in certain regions of the central nervous system and has a longer duration of action than synthetic mammalian calcitonin.

Calcitonin is produced by the parafollicular cells of the thyroid and the postbranchial glands of non-mammalian vertebrates, and consists of more than 30 amino acids. This product is extracted from fish, pigs, cattle, sheep and humans respectively. Due to different sources, the amino acid sequence in its structure is also different. Among them, salmon calcitonin and eel calcitonin have higher activity than mammalian calcitonin. There are synthetic ones, including salmon calcitonin (SalmonCalcitonin, Salcatonin, Miacalcic) and eel calcitonin (Ecalcitonin, Yigaining EelCalcitonin, Elcatonin), which have been used clinically.

Details

Wuhan Kanal Technology Co., Ltd. founded in 2010,it is a large manufacturer of fine Pharmaceutical& Chemical & Cosmetic materials that integrates R&D, production and sales together.  Our Kanal company is established under the support of the Wuhan city government, so Kanal has large advantages in enterprise credit, finance security, product quality control, and cargo export.Kanal locates in the national new materials industry park of Wuhan city and is awarded the title of high-tech corporation.

Wuhan Kanal has its own R&D and development laboratory. We Kanal set up a R&D team with rich experience and strong technical strength, most of the practitioners have more than ten years' experience and technology in organic synthesis development. It owns almost 15 acre and more than 280 workers.

An ISO 9001 & GMP qualified company, we are mainly specialized in producing high quality but low price Pharmaceutical intermediates, APIs and other fine chemicals & cosmetics products which related to human and animals medicines as well as additives in gas &oil field, almost half of the goods are for exporting. What's more, we provide the OEM (customize) manufactures, if you can't find materials from the world, then tell us, we will research and produce in our high-tech equipmented laboratory. We are dedicated to satisfying our customers with our products and services.


1. We has 11 years' exporting experience in active pharmaceutical ingredient products.
Our professional and thoughtful after-sales service eliminates your worries.

2.We can provide you with ten thousands of products of different levels.

3. We offer convenient one-station purchasing service.

(1)Any inquiries will be replied within 12 hours.
(2)Dedication to quality, supply & service.
(3)Strictly on selecting raw materials.
(4)Reasonable & competitive price, fast lead time.

Our company is based on the optical valley biological city,making full use of the park policy advantages, focusing on the research and development of biological medicine.

The pharmaceutical intermediates are mainly applied to anti-cancer, anti-depression, cardiovascular, diabetes and other new medicine. The chemical intermediates mainly refer to heterocyclics and OLED intermediates.Our factory produce new fine chemical materials which are mainly used in water treatment, bactericidal and anti-corrosion, dyes, electronic materials and other industry fields.
Wuhan Kanal has export & import license, and hazard chemical sales license. The products are exported to America, Brazil, South Korea, Japan, Taiwan, Malaysia, Thailand, Indonesia, Europe union and other countries or regions. 
Under rich experiences and excellent international reputation, the company becomes a quite influential enterprise in China's API field. Wuhan Kanal sincerely look forward to establishing long good cooperation with our customers from all over the world.

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog